TESAMORELIN 10 mg

$39.95

Out of stock

Peptide Tesamorelin (10 mg) is a laboratory-grade research peptide supplied as a lyophilized powder. It is intended for controlled scientific and educational research applications conducted by qualified professionals.

Specifications

  • Quantity: 10 mg

  • Form: Lyophilized powder

  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂

  • Molecular Weight: 5135.9 Da

  • Important: This item is supplied as a lyophilized, research-grade powder and is not shipped in liquid form.

  • Storage: Store in a cool, dry place away from direct light

Peptide Information

  • Tesamorelin – A synthetic peptide researched for its interaction with growth hormone–releasing pathways and related endocrine signaling mechanisms.

Intended Use & Disclaimer

This product is provided for research purposes only. It is not for human or veterinary consumption and must not be used as a drug, dietary supplement, cosmetic, or food product.

Peptide Tesamorelin has not been evaluated by the FDA and is not intended to diagnose, treat, cure, or prevent any disease. Purchase and use are restricted to authorized research personnel or institutions conducting lawful scientific research.

By purchasing this product, you acknowledge and agree to these terms and assume full responsibility for its proper handling and use.

Terms of Sale

By purchasing this product, you confirm that you are a qualified professional conducting lawful scientific research. 405 Peptides and its affiliates assume no responsibility for misuse or improper handling of this material.

Contact

Get in touch

Support

© 2025 Copyright. 405peptides. All rights reserved.

All products sold by 405 Peptides are intended for laboratory research purposes only. Not for human or veterinary consumption. Not for use as a drug, food, dietary supplement, cosmetic, or medical device. These products have not been evaluated by the FDA.