Research Use Only | Third-Party Tested | Secure Checkout | Fast Shipping
TESAMORELIN 10 mg
$39.95
Out of stock
Peptide Tesamorelin (10 mg) is a laboratory-grade research peptide supplied as a lyophilized powder. It is intended for controlled scientific and educational research applications conducted by qualified professionals.
Specifications
Quantity: 10 mg
Form: Lyophilized powder
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂
Molecular Weight: 5135.9 Da
Important: This item is supplied as a lyophilized, research-grade powder and is not shipped in liquid form.
Storage: Store in a cool, dry place away from direct light
Peptide Information
Tesamorelin – A synthetic peptide researched for its interaction with growth hormone–releasing pathways and related endocrine signaling mechanisms.
Intended Use & Disclaimer
This product is provided for research purposes only. It is not for human or veterinary consumption and must not be used as a drug, dietary supplement, cosmetic, or food product.
Peptide Tesamorelin has not been evaluated by the FDA and is not intended to diagnose, treat, cure, or prevent any disease. Purchase and use are restricted to authorized research personnel or institutions conducting lawful scientific research.
By purchasing this product, you acknowledge and agree to these terms and assume full responsibility for its proper handling and use.
Terms of Sale
By purchasing this product, you confirm that you are a qualified professional conducting lawful scientific research. 405 Peptides and its affiliates assume no responsibility for misuse or improper handling of this material.
Contact
Get in touch
Support
© 2025 Copyright. 405peptides. All rights reserved.